Cash.App is an established domain. It was registered on March 29, 2018 for 3 years by Square, Inc., a California, USA company.
Its Alexa rank is 10,474 as of August 6, 2020.
According to SimilarWeb.com, 84% of the site’s visitors come from the United States. It is the 2,296 most popular site in the US, getting over 6 million visits per month!
What is Cash.App?
Cash App is a mobile banking app, which offers a method of using and investing money. It has the following features:
- Protects payments and investments with a pass code, allowing you to pause spending with one tap if you lose access.
- Free and fast to join and use
- Send and receive money, including making payments and transferring money instantly to a bank account
- Upon joining, you get a completely free virtual Visa debit card in minutes
- A custom physical debit card will be delivered to you physically in about a week from joining
- Allows to invest in (buy/sell) stocks commission-free with a minimum investment of $1
- Buy, sell, deposit, and withdraw Bitcoin
Brokerage services provided by Cash App Investing LLC, member FINRA / SIPC.
Is Cash.App a Scam?
Well, when using any investing app, you should keep in mind that investing involves risk of losing money. Investments through Cash.App are not FDIC insured. Never invest money you cannot afford to lose.
But not every investment app is a scam.
In fact, Cash.App appears to be legitimate, judging by the reviews on the Google Play Store, where its score is 4.2 stars out of 5.
In the App Store it is ranked #1 in Finance with 4.5 stars (out of 5).
Some of the most useful reviews include:
So far love this app. Easy to setup and use. Very straightforward and simple process to set up account. Great way to pay friends or family if you cant meet them. Would definitely recommend this to anyone. Your bank account information is always hidden and secure, then you have and use a fake debit card that has your bank account info to make payments. You can also receive payments, use bitcoin, design your own debit card, and so much more.
I love this app. Instead of always taking out money and then sending it Western Union. The line to wait, filing out a form, waiting for it to send sign. After that send the person your sending the funds to the number so they can get those funds. The prices you pay just to send the money. Cash App took a load off of me. Now it’s quick and easy. Oh and Cheaper Definitely. ๐๐๐
However, there are also some negative reviews highlighting the problems with Cash.App. For example:
I can’t get back in to my account whenever I log out of it. It says “Unable to sign into this device”. Now I emailed support using another email, after following all instructions they ended up disabling the account and I have a pending amount of money going in there. Your service sucks, I don’t ever want to use this app again and won’t recommend it to anyone even in my dreams. This one star is too much rating for you guys even!!
It’s fine to use when everything is smooth sailing but the support center is absolutely horrible. I got a new number and it’s been made exceedingly complicated to access the account attached to my old number. You can’t just call for help, you have to make a new account to request help, and its all through email. They don’t get back to me half the time and the half attempt at a solution has always been unrelated. Still cant access my account.
To summarize, the app appears to be useful and easy to use. However, there are some technical problems and perhaps the support is not adequate.
The company did reply to that last negative review, writing:
For security reasons, this is currently our only way to get into old accounts. Our team should have solved this for you, but if not, please reach back out via email or you can contact us on Twitter (@CashSupport) or Facebook (@SquareCash).
CashAppTreat.com Scam
If you navigate to CashAppTreat.com, you will be redirected to YouTube. Specifically, to a Subscribe to Channel window, promoting you to subscribe to a channel known as Cash App Guy. The channel is currently empty, or if it has any videos on it, they are private or unlisted.
The YouTube channel has been established on June 15, 2020.
Now Cash.App’s logo is the same as the Cash App Guy’s YouTube channel, raising the question of whether the two services belong to the same entity. Rather, it seems more likely that the owner of the YouTube channel and referring domains (CashAppTreat.com and CashAppClaim.com) is a Cash App affiliate.
Cash.App do have an affiliate program, though it is not very generous. Affiliates earn $5 when they refer someone who goes on sending $5 or more from a newly created Cash App account with a linked a debit card. They payment has to be made within 14 days of opening the new account.
Why would they redirect people to this page?
Obviously they are trying to build a channel by collecting subscribers.
Why would they collect subscribers before the channel even has any content on it?
We can think of two possibilities.
- Perhaps they are in the business of selling YouTube channels. No one would buy a YouTube channel bereft of any subscribers. So they have to first create a large subscribe base, and only then would they be able to offer the channel for sale. You can’t make money with ads before reaching a certain number of subscribers (at least 10,000).
- Maybe they prefer to have a subscriber base before they start uploading content. This may be because their content may cause the channel to be quickly terminated by YouTube and they would like to go viral for at least a short while.
Alternatively, the channel’s content may exist but be private or unlisted. And only specific users may see them.
Help us solve the mystery, by commenting below, answering a very simple question: Where did you discover a link to this site?
Some additional details about CashAppTreat.com
The domain’s Alexa Rank for global internet traffic and engagement over the past 90 days is 5,684,492, meaning it is ranked pretty well for a site with no content, which was registered about 1 week ago at the time of writing this review.
The domain CashAppTreat.com was registered on July 29, 2020 for just one year via NameCheap, indicating this is probably going to be a short-lived scam. It is also protected by Cloudflare and the identity of the domain owner is protected by WhoisGuard, Inc.
CashAppClaim.com
Another related domain is CashAppClaim.com. This domain has an Alexa rank of 7,606,448. It was registered for one year on May 17, 2020, also on NameCheap and is protected by the same services as CashAppTreat.com.
Interestingly, however, this domain redirected to a third site, Cash.App.
Cash App Text Messages
Americans are reporting getting phishing messages that allegedly come from Cash.App, asking for your sign-in code or saying there are pending transfers. There may also be fake Cash App customer support telephone numbers which are used to phish information over the phone.
Cash App does not offer customer service via telephone or SMS.
Moreover, Cash App will never ask for your sign-in code or PIN.
If you believe that you have fallen victim to a phishing scam, make sure to change your Cash App PIN immediately and report the incident.
Following is an example of a Cash App text scam.
$750 Cash App Pending Transfer Confirmation
There is a fake Cash App Transfer text message being sent, claiming there is a pending transfer awaiting your confirmation. It looks like this:
$750 Cash-App-Transfer is pending your confirmation, [random string].com/[my phone number] [random string].
People report receiving this SMS even if they don’t have a cash.app account or have no transactions in place.
The link leads to a domain name composed of a random string of letters, such as:
- wdzmsc.com
- snqexh.com
- T6aixi.com
All of these domains were registered with the NameCheap, Inc. registrar between August 19 and August 20 for one year and the identity of the owner is hidden by a privacy service provided by WhoisGuard, Inc.
The second random string have been reported as:
- nxnrxqr
- rjnnafh
- teqcrw
- fctmqv
- xmvcpub
The same scam is also sent by email. The sender emails include:
- cashappalertstdoinxfiuoglophahc@yahoo.com
- cashappalertskrrjgcwnshbxxwfjlh@yahoo.com
- cashappalertspdcjfybxmlhjafrrai@yahoo.com
- cashappalertsoasjpwvxmgfadrwwme@yahoo.com
- cashappalertsfmsqctqpwdttpwryli@yahoo.com
- Cashappsalertbahpa@yahoo.com
The email reads:
750USD Cash*App requires your confirmation [Telegram Link]?amp1=[my phone number] [random string]
It contains a Telegram link, such as:
- t.co/RJOVG-WH6UF
- t.co/z7cx3sxmnl
The second random string in the email was reported as:
- iwqten
- nxnrxqr
Perhaps the most worrying report is from a person who said he got an email which included a picture of his or her grandchildren.